PDB entry 7d6f

View 7d6f on RCSB PDB site
Description: The crystal structure of ARMS-PBM/MAGI2-PDZ4
Class: structural protein
Keywords: PBM/PDZ interaction, scaffold protein, synaptic polaricity, STRUCTURAL PROTEIN
Deposited on 2020-09-30, released 2020-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-11-04, with a file datestamp of 2020-10-30.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
  Species: Mus musculus [TaxId:10090]
  Gene: Magi2, Acvrinp1, Aip1, Arip1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WVQ1
  Domains in SCOPe 2.07: d7d6fa_
• Chain 'B':
  Compound: Kinase D-interacting substrate of 220 kDa
  Species: Rattus norvegicus [TaxId:10116]
  Gene: Kidins220, Arms
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9EQG6 (Start-18)

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >7d6fA (A:)
  gpgsslqtsdvvihrkenegfgfviisslnrpesgatitvphkigriidgspadrcaklk
  vgdrilavngqsiinmphadivklikdaglsvtlriipqee
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >7d6fA (A:)
  qtsdvvihrkenegfgfviisslatitvphkigriidgspadrcaklkvgdrilavngqs
  iinmphadivklikdaglsvtlriipq
  

  
  
• Chain 'B':
  No sequence available.