PDB entry 7d6f
View 7d6f on RCSB PDB site
Description: The crystal structure of ARMS-PBM/MAGI2-PDZ4
Class: structural protein
Keywords: PBM/PDZ interaction, scaffold protein, synaptic polaricity, STRUCTURAL PROTEIN
Deposited on
2020-09-30, released
2020-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated
2020-11-04, with a file datestamp of
2020-10-30.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.21
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
Species: Mus musculus [TaxId:10090]
Gene: Magi2, Acvrinp1, Aip1, Arip1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d7d6fa_ - Chain 'B':
Compound: Kinase D-interacting substrate of 220 kDa
Species: Rattus norvegicus [TaxId:10116]
Gene: Kidins220, Arms
Database cross-references and differences (RAF-indexed):
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>7d6fA (A:)
gpgsslqtsdvvihrkenegfgfviisslnrpesgatitvphkigriidgspadrcaklk
vgdrilavngqsiinmphadivklikdaglsvtlriipqee
Sequence, based on observed residues (ATOM records): (download)
>7d6fA (A:)
qtsdvvihrkenegfgfviisslatitvphkigriidgspadrcaklkvgdrilavngqs
iinmphadivklikdaglsvtlriipq
- Chain 'B':
No sequence available.