PDB entry 7d4a

View 7d4a on RCSB PDB site
Description: The Crystal Structure of human JMJD2A Tudor domain from Biortus
Class: oxidoreductase
Keywords: catalytic activity, demethylase activity, histone demethylase activity, OXIDOREDUCTASE
Deposited on 2020-09-23, released 2020-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-10-07, with a file datestamp of 2020-10-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysine-specific demethylase 4a
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM4A, JHDM3A, JMJD2, JMJD2A, KIAA0677
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75164 (17-130)
      • expression tag (15-16)
    Domains in SCOPe 2.08: d7d4aa1, d7d4aa2, d7d4aa3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7d4aA (A:)
    mgsshhhhhhenlyfqgsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdn
    lypedivsqdclqfgppaegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkr
    ddvytldeelp
    

    Sequence, based on observed residues (ATOM records): (download)
    >7d4aA (A:)
    qgsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdclqfg
    ppaegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytldeelp