PDB entry 7d3d

View 7d3d on RCSB PDB site
Description: Crystal structure of SPOP bound with a peptide
Class: protein binding
Keywords: ccRCC, E3 ligase adaptor SPOP, ubiquitination, SBC motif(F-pS-S/T-S/T;F is nonpolar, p is polar), PROTEIN BINDING
Deposited on 2020-09-18, released 2020-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-09, with a file datestamp of 2021-06-04.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Speckle-type POZ protein
    Species: Homo sapiens [TaxId:9606]
    Gene: SPOP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7d3da_
  • Chain 'B':
    Compound: Speckle-type POZ protein
    Species: Homo sapiens [TaxId:9606]
    Gene: SPOP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7d3db_
  • Chain 'a':
    Compound: glu-val-ser-ile-ile-gln-gly-ala-asp-ser-thr-thr
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 7D3D (0-11)
  • Chain 'b':
    Compound: glu-val-ser-ile-ile-gln-gly-ala-asp-ser-thr-thr
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 7D3D (0-11)
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7d3dA (A:)
kvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeeskdylsly
lllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdflldean
gllpddkltlfcevsvvqd

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >7d3dB (B:)
kvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeeskdylsly
lllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdflldean
gllpddkltlfcevsvvqd

    Sequence, based on observed residues (ATOM records): (download) 
    >7d3dB (B:)
vvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeeskdylslyl
llvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdflldeang
llpddkltlfcevsvvqd

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.