PDB entry 7d35

View 7d35 on RCSB PDB site
Description: human lc8 bound to ebola virus vp35(67-76)
Deposited on 2020-09-18, released 2021-04-14
The last revision was dated 2021-04-14, with a file datestamp of 2021-04-09.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: DYNLL1, DLC1, DNCL1, DNCLC1, HDLC1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Peptide from Polymerase cofactor VP35
    Species: Ebola virus, synthetic [TaxId:1570291]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >7d35A (A:)
ghmcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhciv
grnfgsyvthetkhfiyfylgqvaillfksg

    Sequence, based on observed residues (ATOM records):
    >7d35A (A:)
drkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgrnf
gsyvthetkhfiyfylgqvaillfks

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >7d35B (B:)
ktrnsqtqtd