PDB entry 7d18

View 7d18 on RCSB PDB site
Description: crystal structure of acidobacteriales bacterium glutaminyl cyclase
Deposited on 2020-09-14, released 2021-04-14
The last revision was dated 2021-05-05, with a file datestamp of 2021-04-30.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidase M28
    Species: Acidobacteriales bacterium 59-55 [TaxId:1895690]
    Gene: BGO25_06485
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, NA, SO4, GOL, TRS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >7d18A (A:)
aqkapaqnsparfngqaaynltrqyiaaapkrwvgspghakaeafikdhfkpeiaqgrfe
tdrftagtpagllemrnyivrypgkkdgvivlathyetnyplrdinfvgandggsttall
iemgnylrahppqgysiwlvfddgeeaiqswsatdslygtrhlaakwsqdgtlkkikafl
ladmigdkdlnidrdanstpwlldmlkqaakntghsayvfknstaveddhlpfakrgvpv
ldiididygprtfsmpdgyhhtaedtldkisahslqiagdlflemirlinqrg