PDB entry 7d0p

View 7d0p on RCSB PDB site
Description: Crystal structure of human HBO1-BRPF2 in complex with propionyl-coenzyme A
Class: transferase
Keywords: histone acetyltransferase, complex, HBO1, BRPF2, propionyl-CoA, acylation, TRANSFERASE
Deposited on 2020-09-11, released 2021-07-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-28, with a file datestamp of 2021-07-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase KAT7
    Species: Homo sapiens [TaxId:9606]
    Gene: KAT7, HBO1, HBOa, MYST2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7d0pa_
  • Chain 'B':
    Compound: BRD1 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 1VU, ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7d0pA (A:)
miktiafgryeldtwyhspypeeyarlgrlymcefclkymksqtilrrhmakcvwkhppg
deiyrkgsisvfevdgkknkiycqnlcllaklfldhktlyydvepflfyvmteadntgch
ligyfskeknsflnynvsciltmpqymrqgygkmlidfsyllskveekvgsperplsdlg
lisyrsywkevllrylhnfqgkeisikeisqetavnpvdivstlqalqmlkywkgkhlvl
krqdlidewiakeakrsnsnktmdpsclkwtppkgt

  • Chain 'B':
    No sequence available.