PDB entry 7d0e

View 7d0e on RCSB PDB site
Description: crystal structure of fip200 claw/p-ccpg1 fir2
Deposited on 2020-09-09, released 2021-03-31
The last revision was dated 2021-03-31, with a file datestamp of 2021-03-26.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RB1-inducible coiled-coil protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RB1CC1, KIAA0203, RBICC
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Cell cycle progression protein 1 FIR2
    Species: Homo sapiens [TaxId:9606]
    Gene: CCPG1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SEP, GO9, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >7d0eA (A:)
srhsekiairdfqvgdlvliilderhdnyvlftvsptlyflhseslpaldlkpgegasga
srrpwvlgkvmekeycqakkaqnrfkvplgtkfyrvkavswnkkv

    Sequence, based on observed residues (ATOM records):
    >7d0eA (A:)
srhsekiairdfqvgdlvliilderhdnyvlftvsptlyflhseslpaldlkpgsrrpwv
lgkvmekeycqakkaqnrfkvplgtkfyrvkavswn

  • Chain 'B':
    Sequence, based on SEQRES records:
    >7d0eB (B:)
sddsdivtleppk

    Sequence, based on observed residues (ATOM records):
    >7d0eB (B:)
dsdivtleppk