PDB entry 7czx

View 7czx on RCSB PDB site
Description: S protein of SARS-CoV-2 in complex bound with P5A-1B9
Class: viral protein
Keywords: SARS-CoV-2, antibody, VIRAL PROTEIN
Deposited on 2020-09-09, released 2021-03-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-05-19, with a file datestamp of 2021-05-14.
Experiment type: EM
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spike glycoprotein
    Species: Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049]
    Gene: S, 2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DTC2
      • conflict (985-986)
  • Chain 'B':
    Compound: Spike glycoprotein
    Species: Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049]
    Gene: S, 2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DTC2
      • conflict (985-986)
  • Chain 'C':
    Compound: Spike glycoprotein
    Species: Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049]
    Gene: S, 2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DTC2
      • conflict (985-986)
  • Chain 'H':
    Compound: Immunoglobulin heavy variable 4-59,chain H of P5A-1B9,IGH@ protein
    Species: Homo sapiens [TaxId:9606]
    Gene: IGH@
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01825 (0-95)
      • conflict (51)
      • conflict (70)
    • PDB 7CZX (96-112)
    • Uniprot Q6GMX6 (113-End)
      • conflict (116)
      • conflict (119)
  • Chain 'I':
    Compound: Immunoglobulin heavy variable 4-59,chain H of P5A-1B9,IGH@ protein
    Species: Homo sapiens [TaxId:9606]
    Gene: IGH@
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01825 (0-95)
      • conflict (51)
      • conflict (70)
    • PDB 7CZX (96-112)
    • Uniprot Q6GMX6 (113-End)
      • conflict (116)
      • conflict (119)
  • Chain 'J':
    Compound: Immunoglobulin heavy variable 4-59,chain H of P5A-1B9,IGH@ protein
    Species: Homo sapiens [TaxId:9606]
    Gene: IGH@
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01825 (0-95)
      • conflict (51)
      • conflict (70)
    • PDB 7CZX (96-112)
    • Uniprot Q6GMX6 (113-End)
      • conflict (116)
      • conflict (119)
  • Chain 'K':
    Compound: IG c168_light_IGKV4-1_IGKJ4,Uncharacterized protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7czxk1, d7czxk2
  • Chain 'M':
    Compound: IG c168_light_IGKV4-1_IGKJ4,Uncharacterized protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7czxm1, d7czxm2
  • Chain 'N':
    Compound: IG c168_light_IGKV4-1_IGKJ4,Uncharacterized protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7czxn1, d7czxn2
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7czxK (K:)
divmtqspdslavslgeratinckssqsvlyssnnknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpltfgggtkveikrtvaaps
vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
lsstltlskadyekhkvyacevthqglsspvtksfnrgec

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7czxM (M:)
divmtqspdslavslgeratinckssqsvlyssnnknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpltfgggtkveikrtvaaps
vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
lsstltlskadyekhkvyacevthqglsspvtksfnrgec

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7czxN (N:)
divmtqspdslavslgeratinckssqsvlyssnnknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpltfgggtkveikrtvaaps
vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
lsstltlskadyekhkvyacevthqglsspvtksfnrgec