PDB entry 7cwh

View 7cwh on RCSB PDB site
Description: structural basis of rack7 phd to read a pediatric glioblastoma- associated histone mutation h3.3g34r
Deposited on 2020-08-28, released 2021-05-26
The last revision was dated 2021-05-26, with a file datestamp of 2021-05-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide from Histone H3.3
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84243 (0-10)
      • engineered mutation (3)
  • Chain 'B':
    Compound: protein kinase c-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ZMYND8
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >7cwhA (A:)
stgrvkkphry

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >7cwhB (B:)
qdgrndfycwvchregqvlccelcprvyhakclrltsepegdwfcpecekitvaecietq
s