PDB entry 7ct3

View 7ct3 on RCSB PDB site
Description: crystal structure of mglc from myxococcus xanthus
Deposited on 2020-08-17, released 2021-01-27
The last revision was dated 2021-07-14, with a file datestamp of 2021-07-09.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mutual gliding motility protein C (MglC)
    Species: Myxococcus xanthus DK 1622 [TaxId:246197]
    Gene: MXAN_5770
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >7ct3A (A:)
msfrthlesvvnqvegalacsvmgfdgisvdtfqkdesaeldlngawveyanlltqlrna
aetlktgtvsevsvnsekvltvmrlvspdyflvlalhadgnfgkgryvlrvtapkvrael