PDB entry 7csq

View 7csq on RCSB PDB site
Description: Solution structure of the complex between p75NTR-DD and TRADD-DD
Class: apoptosis
Keywords: p75 NTR, death domain, TRADD, APOPTOSIS
Deposited on 2020-08-16, released 2021-08-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-08-25, with a file datestamp of 2021-08-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor receptor superfamily member 16
    Species: Homo sapiens [TaxId:9606]
    Gene: Ngfr, Tnfrsf16
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7csqa_
  • Chain 'B':
    Compound: Tumor necrosis factor receptor type 1-associated DEATH domain protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TRADD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7csqb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7csqA (A:)
    kgdgglysslppakreevekllngsagdtwrhlagelgyqpehidsftheacpvrallas
    watqdsatldallaalrriqradlveslcsestatspv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7csqB (B:)
    aqtflfqgqpvvnrplslkdqqtfarsvglkwrkvgrslqrgcralrdpaldslayeyer
    eglyeqafqllrrfvqaegrratlqrlvealeeneltslaedllgltdpnggla