PDB entry 7csq

View 7csq on RCSB PDB site
Description: Solution structure of the complex between p75NTR-DD and TRADD-DD
Class: apoptosis
Keywords: p75 NTR, death domain, TRADD, APOPTOSIS
Deposited on 2020-08-16, released 2021-08-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-08-25, with a file datestamp of 2021-08-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tumor necrosis factor receptor superfamily member 16
  Species: Homo sapiens [TaxId:9606]
  Gene: Ngfr, Tnfrsf16
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08138 (0-97)
  Domains in SCOPe 2.08: d7csqa_
• Chain 'B':
  Compound: Tumor necrosis factor receptor type 1-associated DEATH domain protein
  Species: Homo sapiens [TaxId:9606]
  Gene: TRADD
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15628 (0-113)
  Domains in SCOPe 2.08: d7csqb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7csqA (A:)
  kgdgglysslppakreevekllngsagdtwrhlagelgyqpehidsftheacpvrallas
  watqdsatldallaalrriqradlveslcsestatspv
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7csqB (B:)
  aqtflfqgqpvvnrplslkdqqtfarsvglkwrkvgrslqrgcralrdpaldslayeyer
  eglyeqafqllrrfvqaegrratlqrlvealeeneltslaedllgltdpnggla