PDB entry 7cnc

View 7cnc on RCSB PDB site
Description: cystal structure of human ERH in complex with DGCR8
Class: protein binding
Keywords: Protein-protein interaction, PROTEIN BINDING
Deposited on 2020-07-30, released 2020-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-11-18, with a file datestamp of 2020-11-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enhancer of rudimentary homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: ERH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7cnca_
  • Chain 'B':
    Compound: Microprocessor complex subunit DGCR8
    Species: Homo sapiens [TaxId:9606]
    Gene: DGCR8, C22orf12, DGCRK6, LP4941
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7cncA (A:)
    mghhhhhhmshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsity
    disqlfdfiddladlsclvyradtqtyqpynkdwikekiyvllrrqaqqagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >7cncA (A:)
    mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdf
    iddladlsclvyradtqtyqpynkdwikekiyvllrrqaq
    

  • Chain 'B':
    No sequence available.