PDB entry 7cnc
View 7cnc on RCSB PDB site
Description: cystal structure of human ERH in complex with DGCR8
Class: protein binding
Keywords: Protein-protein interaction, PROTEIN BINDING
Deposited on
2020-07-30, released
2020-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated
2020-11-18, with a file datestamp of
2020-11-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.53
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Enhancer of rudimentary homolog
Species: Homo sapiens [TaxId:9606]
Gene: ERH
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d7cnca_ - Chain 'B':
Compound: Microprocessor complex subunit DGCR8
Species: Homo sapiens [TaxId:9606]
Gene: DGCR8, C22orf12, DGCRK6, LP4941
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>7cncA (A:)
mghhhhhhmshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsity
disqlfdfiddladlsclvyradtqtyqpynkdwikekiyvllrrqaqqagk
Sequence, based on observed residues (ATOM records): (download)
>7cncA (A:)
mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdf
iddladlsclvyradtqtyqpynkdwikekiyvllrrqaq
- Chain 'B':
No sequence available.