PDB entry 7cnc

View 7cnc on RCSB PDB site
Description: cystal structure of human ERH in complex with DGCR8
Class: protein binding
Keywords: Protein-protein interaction, PROTEIN BINDING
Deposited on 2020-07-30, released 2020-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-11-18, with a file datestamp of 2020-11-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Enhancer of rudimentary homolog
  Species: Homo sapiens [TaxId:9606]
  Gene: ERH
  Database cross-references and differences (RAF-indexed):
  • Uniprot P84090 (8-End)
  Domains in SCOPe 2.08: d7cnca_
• Chain 'B':
  Compound: Microprocessor complex subunit DGCR8
  Species: Homo sapiens [TaxId:9606]
  Gene: DGCR8, C22orf12, DGCRK6, LP4941
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8WYQ5 (0-End)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >7cncA (A:)
  mghhhhhhmshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsity
  disqlfdfiddladlsclvyradtqtyqpynkdwikekiyvllrrqaqqagk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >7cncA (A:)
  mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdf
  iddladlsclvyradtqtyqpynkdwikekiyvllrrqaq
  

  
  
• Chain 'B':
  No sequence available.