PDB entry 7cn7

View 7cn7 on RCSB PDB site
Description: T4 phage spackle protein gp61.3 complex with lysozyme domain of gp5 tail lysozyme
Class: viral protein
Keywords: Lysozyme inhibitor complex, Phage, Lysis inhibition, VIRAL PROTEIN
Deposited on 2020-07-30, released 2020-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-10-14, with a file datestamp of 2020-10-09.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Baseplate central spike complex protein gp5
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7cn7a_
  • Chain 'C':
    Compound: Protein spackle
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: sp, 61.3
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 1PG, EDO, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7cn7A (A:)
    plseiptddnpnmsmaemlrrdeglrlkvywdtegyptigighlimkqpvrdmaqinkvl
    skqvgreitgnpgsitmeeattlferdladmqrdikshskvgpvwqavnrsrqmalenma
    fqmgvggvakfntmltamlagdwekaykagrdslwyqqtkgrasrvtmiiltgnlesygv
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >7cn7A (A:)
    eiptddnpnmsmaemlrrdeglrlkvywdtegyptigighlimkqpvrdmaqinkvlskq
    vgreitgnpgsitmeeattlferdladmqrdikshskvgpvwqavnrsrqmalenmafqm
    gvggvakfntmltamlagdwekaykagrdslwyqqtkgrasrvtmiiltgnlesygve
    

  • Chain 'C':
    No sequence available.