PDB entry 7cmn

View 7cmn on RCSB PDB site
Description: Crystal Structure of Bacillus sp. TB-90 Urate Oxidase Improved by Humidity Control at 88% RH.
Class: oxidoreductase
Keywords: protein engineering, enzyme, loop flexibility, entropy of activation, OXIDOREDUCTASE
Deposited on 2020-07-28, released 2020-08-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-08-12, with a file datestamp of 2020-08-07.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uric acid degradation bifunctional protein
    Species: Bacillus sp. (strain TB-90) [TaxId:36824]
    Gene: uao
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7cmna1, d7cmna2
  • Chain 'B':
    Compound: Uric acid degradation bifunctional protein
    Species: Bacillus sp. (strain TB-90) [TaxId:36824]
    Gene: uao
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7cmnb1, d7cmnb2
  • Heterogens: OXY, AZA, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7cmnA (A:)
    rvmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgd
    nslvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettf
    avkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvg
    firdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetet
    lsiqhliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprppygfqcf
    tvtqedlphenil
    

    Sequence, based on observed residues (ATOM records): (download)
    >7cmnA (A:)
    vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
    slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
    vnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgfird
    eyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetlsiq
    hliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprppygfqcftvtq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >7cmnB (B:)
    rvmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgd
    nslvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettf
    avkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvg
    firdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetet
    lsiqhliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprppygfqcf
    tvtqedlphenil
    

    Sequence, based on observed residues (ATOM records): (download)
    >7cmnB (B:)
    vmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgdn
    slvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettfa
    vkngnraaselvfkksrneyataylnmvrnedntlniteqqsglaglqlikvsgnsfvgf
    irdeyttlpedsnrplfvylnikwkykntedsfgtnpenyvaaeqirdiatsvfhetetl
    siqhliyligrrilerfpqlqevyfesqnhtwdkiveeipesegkvyteprppygfqcft
    vtq