PDB entry 7ckd

View 7ckd on RCSB PDB site
Description: solution structure of ncr169 oxidized form 1 from medicago truncatula
Deposited on 2020-07-16, released 2021-05-26
The last revision was dated 2021-05-26, with a file datestamp of 2021-05-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nodule Cysteine-Rich (NCR) secreted peptide
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g029760
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7KHA7 (1-38)
      • expression tag (0)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >7ckdA (A:)
gedighikycgivddcykskkplfkiwkcvenvcvlwyk