PDB entry 7cjv

View 7cjv on RCSB PDB site
Description: solution structure of monomeric superoxide dismutase 1 with an additional mutation h46w in a dilute environment
Deposited on 2020-07-14, released 2021-05-26
The last revision was dated 2021-05-26, with a file datestamp of 2021-05-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monomeric Human Cu,Zn Superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • PDB 7CJV (0-109)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >7cjvA (A:)
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfwvhgaggdlgnvtad
kdgvadvsiedsvislsgdhsiigrtlvvhekagagagsrlasgvigiaq