PDB entry 7cjl

View 7cjl on RCSB PDB site
Description: Metallo-Beta-Lactamase VIM-2 in complex with (S)-N-(3-(2H-tetrazol-5-yl)phenyl)-3-mercapto-2-methylpropanamide
Class: hydrolase
Keywords: Metallo-beta-lactamase VIM-2, VIM-2, HYDROLASE
Deposited on 2020-07-11, released 2021-07-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-14, with a file datestamp of 2021-07-09.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta-lactamase class b vim-2
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: blaVIM-2, bla vim-2, bla-VIM-2, blasVIM-2, blaVIM2, blm, VIM-2, vim-2, PAERUG_P32_London_17_VIM_2_10_11_06255
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9K2N0 (0-230)
  Domains in SCOPe 2.08: d7cjla_
• Chain 'B':
  Compound: beta-lactamase class b vim-2
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: blaVIM-2, bla vim-2, bla-VIM-2, blasVIM-2, blaVIM2, blm, VIM-2, vim-2, PAERUG_P32_London_17_VIM_2_10_11_06255
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9K2N0 (0-230)
  Domains in SCOPe 2.08: d7cjlb_
• Heterogens: G0O, ZN, FMT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7cjlA (A:)
  eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
  taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
  thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
  adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnr
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7cjlB (B:)
  eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
  taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
  thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
  adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnr