PDB entry 7ciz

View 7ciz on RCSB PDB site
Description: Crystal structure of DNAJC9 HBD helix2 in complex with H3.3-H4 dimer and MCM2 HBD
Class: chaperone
Keywords: Histone chaperone, CHAPERONE
Deposited on 2020-07-08, released 2021-04-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-30, with a file datestamp of 2021-06-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3.3
    Species: Homo sapiens [TaxId:9606]
    Gene: H3-3A, H3.3A, H3F3, H3F3A, PP781, H3-3B, H3.3B, H3F3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7ciza_
  • Chain 'B':
    Compound: histone h4
    Species: Homo sapiens [TaxId:9606]
    Gene: HIST1H4A, H4/A, H4FA, HIST1H4B, H4/I, H4FI, HIST1H4C, H4/G, H4FG, HIST1H4D, H4/B, H4FB, HIST1H4E, H4/J, H4FJ, HIST1H4F, H4/C, H4FC, HIST1H4H, H4/H, H4FH, HIST1H4I, H4/M, H4FM, HIST1H4J, H4/E, H4FE, HIST1H4K, H4/D, H4FD, HIST1H4L, H4/K, H4FK, HIST2H4A, H4/N, H4F2, H4FN, HIST2H4, HIST2H4B, H4/O, H4FO, HIST4H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7cizb_
  • Chain 'C':
    Compound: DNA replication licensing factor mcm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MCM2, BM28, CCNL1, CDCL1, KIAA0030
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: DnaJ homolog subfamily C member 9
    Species: Homo sapiens [TaxId:9606]
    Gene: DNAJC9
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WXX5
      • engineered mutation (68)
  • Chain 'E':
    Compound: Histone H3.3
    Species: Homo sapiens [TaxId:9606]
    Gene: H3-3A, H3.3A, H3F3, H3F3A, PP781, H3-3B, H3.3B, H3F3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7cize_
  • Chain 'F':
    Compound: histone h4
    Species: Homo sapiens [TaxId:9606]
    Gene: HIST1H4A, H4/A, H4FA, HIST1H4B, H4/I, H4FI, HIST1H4C, H4/G, H4FG, HIST1H4D, H4/B, H4FB, HIST1H4E, H4/J, H4FJ, HIST1H4F, H4/C, H4FC, HIST1H4H, H4/H, H4FH, HIST1H4I, H4/M, H4FM, HIST1H4J, H4/E, H4FE, HIST1H4K, H4/D, H4FD, HIST1H4L, H4/K, H4FK, HIST2H4A, H4/N, H4F2, H4FN, HIST2H4, HIST2H4B, H4/O, H4FO, HIST4H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7cizf_
  • Chain 'G':
    Compound: DNA replication licensing factor mcm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MCM2, BM28, CCNL1, CDCL1, KIAA0030
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: DnaJ homolog subfamily C member 9
    Species: Homo sapiens [TaxId:9606]
    Gene: DNAJC9
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WXX5
      • engineered mutation (68)
  • Chain 'I':
    Compound: Histone H3.3
    Species: Homo sapiens [TaxId:9606]
    Gene: H3-3A, H3.3A, H3F3, H3F3A, PP781, H3-3B, H3.3B, H3F3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7cizi_
  • Chain 'J':
    Compound: histone h4
    Species: Homo sapiens [TaxId:9606]
    Gene: HIST1H4A, H4/A, H4FA, HIST1H4B, H4/I, H4FI, HIST1H4C, H4/G, H4FG, HIST1H4D, H4/B, H4FB, HIST1H4E, H4/J, H4FJ, HIST1H4F, H4/C, H4FC, HIST1H4H, H4/H, H4FH, HIST1H4I, H4/M, H4FM, HIST1H4J, H4/E, H4FE, HIST1H4K, H4/D, H4FD, HIST1H4L, H4/K, H4FK, HIST2H4A, H4/N, H4F2, H4FN, HIST2H4, HIST2H4B, H4/O, H4FO, HIST4H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7cizj_
  • Chain 'K':
    Compound: DNA replication licensing factor mcm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MCM2, BM28, CCNL1, CDCL1, KIAA0030
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: DnaJ homolog subfamily C member 9
    Species: Homo sapiens [TaxId:9606]
    Gene: DNAJC9
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WXX5
      • engineered mutation (68)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7cizA (A:)
stellirklpfqrlvreiaqdfktdlrfqsaaigalqeaseaylvglfedtnlcaihakr
vtimpkdiqlarrirgera

    Sequence, based on observed residues (ATOM records): (download) 
    >7cizA (A:)
stellirklpfqrlvreiaqdfktdlrfqsaaigalqeaseaylvglfedtnlcaihakr
vtimpkdiqlarrirger

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >7cizB (B:)
sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg

    Sequence, based on observed residues (ATOM records): (download) 
    >7cizB (B:)
rdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvt
amdvvyalkrqgrtly

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download) 
    >7cizE (E:)
stellirklpfqrlvreiaqdfktdlrfqsaaigalqeaseaylvglfedtnlcaihakr
vtimpkdiqlarrirgera

    Sequence, based on observed residues (ATOM records): (download) 
    >7cizE (E:)
tellirklpfqrlvreiaqdfktdlrfqsaaigalqeaseaylvglfedtnlcaihakrv
timpkdiqlarrirgera

  • Chain 'F':
    Sequence, based on SEQRES records: (download) 
    >7cizF (F:)
sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg

    Sequence, based on observed residues (ATOM records): (download) 
    >7cizF (F:)
vlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrkt
vtamdvvyalkrqgrtly

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download) 
    >7cizI (I:)
stellirklpfqrlvreiaqdfktdlrfqsaaigalqeaseaylvglfedtnlcaihakr
vtimpkdiqlarrirgera

    Sequence, based on observed residues (ATOM records): (download) 
    >7cizI (I:)
tellirklpfqrlvreiaqdfktdlrfqsaaigalqeaseaylvglfedtnlcaihakrv
timpkdiqlarrirgera

  • Chain 'J':
    Sequence, based on SEQRES records: (download) 
    >7cizJ (J:)
sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg

    Sequence, based on observed residues (ATOM records): (download) 
    >7cizJ (J:)
vlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrkt
vtamdvvyalkrqgrtly

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.