PDB entry 7cit

View 7cit on RCSB PDB site
Description: Crystal structure of tyrosinase from Streptomyces castaneoglobisporus in complex with the caddie protein obtained by soaking in the solution containing Cu(II) and hydroxylamine for 24 h
Class: metal binding protein
Keywords: tyrosinase, catalytic mechanism, METAL BINDING PROTEIN
Deposited on 2020-07-08, released 2021-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-06-23, with a file datestamp of 2021-06-18.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosinase
    Species: STREPTOMYCES CASTANEOGLOBISPORUS [TaxId:79261]
    Database cross-references and differences (RAF-indexed):
    • PDB 7CIT
    Domains in SCOPe 2.07: d7cita1, d7cita2
  • Chain 'B':
    Compound: MelC
    Species: STREPTOMYCES CASTANEOGLOBISPORUS [TaxId:79261]
    Database cross-references and differences (RAF-indexed):
    • PDB 7CIT
    Domains in SCOPe 2.07: d7citb_
  • Heterogens: G1X, CU, PEO, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7citA (A:)
    mtvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsfl
    pwhrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpf
    aastgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnh
    legwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptgg
    tpdvvdlnetmkpwntvrpadlldhtayytfdalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >7citA (A:)
    tvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsflp
    whrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpfa
    astgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnhl
    egwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptggt
    pdvvdlnetmkpwntvrpadlldhtayytfdalehh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >7citB (B:)
    mpeitrrraltaaaavaatasaavtlaapaasaaghhepaapesfdevykgrriqgrpar
    gaahhhehgggyevfvdgvqlhvmrnadgswisvvshxdpvptpraaaraavdelqgapl
    lpfpanlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >7citB (B:)
    aapesfdevykgrriqgrpahehgggyevfvdgvqlhvmrnadgswisvvshxdpvptpr
    aaaraavdelqgapllpf