PDB entry 7cg8

View 7cg8 on RCSB PDB site
Description: structure of the sensor domain (short construct) of the anti-sigma factor rsgi4 in pseudobacteroides cellulosolvens
Deposited on 2020-06-30, released 2021-06-30
The last revision was dated 2021-06-30, with a file datestamp of 2021-06-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-sigma factor RsgI, N-terminal
    Species: Pseudobacteroides cellulosolvens ATCC 35603 = DSM 2933 [TaxId:398512]
    Gene: Bccel_2225
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Anti-sigma factor RsgI, N-terminal
    Species: Pseudobacteroides cellulosolvens ATCC 35603 = DSM 2933 [TaxId:398512]
    Gene: Bccel_2225
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Anti-sigma factor RsgI, N-terminal
    Species: Pseudobacteroides cellulosolvens ATCC 35603 = DSM 2933 [TaxId:398512]
    Gene: Bccel_2225
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Anti-sigma factor RsgI, N-terminal
    Species: Pseudobacteroides cellulosolvens ATCC 35603 = DSM 2933 [TaxId:398512]
    Gene: Bccel_2225
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PEU, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >7cg8A (A:)
svspveiainpaseitatsafisgtvtkfeqskgfygsgcnisllyweasnpmhvkvass
iskkdfpadisatikdlkphttyqfkvtvnfyfssslqtfktlal

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >7cg8B (B:)
svspveiainpaseitatsafisgtvtkfeqskgfygsgcnisllyweasnpmhvkvass
iskkdfpadisatikdlkphttyqfkvtvnfyfssslqtfktlal

  • Chain 'C':
    Sequence, based on SEQRES records:
    >7cg8C (C:)
svspveiainpaseitatsafisgtvtkfeqskgfygsgcnisllyweasnpmhvkvass
iskkdfpadisatikdlkphttyqfkvtvnfyfssslqtfktlal

    Sequence, based on observed residues (ATOM records):
    >7cg8C (C:)
svspveiainpaseitatsafisgtvtkfeqgsgcnisllyweasnpmhvkvassiskkd
fpadisatikdlkphttyqfkvtvnfyfssslqtfktlal

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >7cg8D (D:)
svspveiainpaseitatsafisgtvtkfeqskgfygsgcnisllyweasnpmhvkvass
iskkdfpadisatikdlkphttyqfkvtvnfyfssslqtfktlal