PDB entry 7cg5

View 7cg5 on RCSB PDB site
Description: structure of the sensor domain (long construct) of the anti-sigma factor rsgi4 in pseudobacteroides cellulosolvens
Deposited on 2020-06-30, released 2021-06-30
The last revision was dated 2021-06-30, with a file datestamp of 2021-06-25.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-sigma factor RsgI, N-terminal
    Species: Pseudobacteroides cellulosolvens ATCC 35603 = DSM 2933 [TaxId:398512]
    Gene: Bccel_2225
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >7cg5A (A:)
mveiainpaseitatsafisgtvtkfeqskgfygsgcnisllyweasnpmhvkvassisk
kdfpadisatikdlkphttyqfkvtvnfyfssslqtfktlaleskstsivststptpsmp
vkvtlehhhhhh

    Sequence, based on observed residues (ATOM records):
    >7cg5A (A:)
mveiainpaseitatsafisgtvtkgcnisllyweasnpmhvkvassiskkdfpadisat
ikdlkphttyqfkvtvnfyfssslqtfktlaleskstsiv