PDB entry 7cfw

View 7cfw on RCSB PDB site
Description: Crystal structure of the receiver domain of sensor histidine kinase PA1611 (PA1611REC) from Pseudomonas aeruginosa PAO1 with calcium ion coordinated in the active site cleft
Class: transferase
Keywords: P. aeruginosa, Two-component regulatory system, Sensor histidine kinase, Histidine-containing phosphotransfer protein, TRANSFERASE
Deposited on 2020-06-29, released 2020-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-11-04, with a file datestamp of 2020-10-30.
Experiment type: XRAY
Resolution: 1.31 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Histidine kinase
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: barA_6, NCTC11839_05765
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A4U9SBT9
  Domains in SCOPe 2.08: d7cfwa_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >7cfwA (A:)
  mgsshhhhhhssglvpagshmdaapvaagqeillvednpvnqtvieamlrslgyrvtlva
  dgiqavrsaerqrydailmdcrlpvldgysatreiraqengrrvpiialtanalqgdren
  clqagmndylakpfkraelqrilqrwigsqpelpvtsnetgrgepe
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >7cfwA (A:)
  agqeillvednpvnqtvieamlrslgyrvtlvadgiqavrsaerqrydailmdcrlpvld
  gysatreiraqengrrvpiialtanalqgdrenclqagmndylakpfkraelqrilqrwi
  gsq