PDB entry 7cfg

View 7cfg on RCSB PDB site
Description: structure of the transmembrane domain of the bacterial cnnm/corc family mg2+ transporter in complex with mg2+
Deposited on 2020-06-25, released 2021-02-24
The last revision was dated 2021-03-10, with a file datestamp of 2021-03-05.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemolysin
    Species: Thermus parvatiensis [TaxId:456163]
    Gene: AV541_07030
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A109QFA5 (Start-157)
      • expression tag (158)
  • Heterogens: MG, ZN, OLC

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >7cfgA (A:)
mspenpwlwavlvlllalsaffsasetaittlypwklkelaeskngpfrllaeditrflt
tilvgnnlvniaatalvtelatqafgsagvgvatgamtflilffgeitpkslavhhaeai
arlaawpiyglsvlfypvgrffslvsggllrllgleprlessglevlfq

    Sequence, based on observed residues (ATOM records):
    >7cfgA (A:)
enpwlwavlvlllalsaffsasetaittlypwklkelaeskngpfrllaeditrflttil
vgnnlvniaatalvtelatqafgsagvgvatgamtflilffgeitpkslavhhaeaiarl
aawpiyglsvlfypvgrffslvsggllrllgleprl