PDB entry 7ceq

View 7ceq on RCSB PDB site
Description: Crystal structure of cysteine desulfurase SufS H121A from Bacillus subtilis
Class: biosynthetic protein
Keywords: cysteine desulfurase, PLP-dependent enzyme, cysteine metabolism, cycloserine, inhibitor, Fe-S cluster biosynthesis, BIOSYNTHETIC PROTEIN
Deposited on 2020-06-24, released 2021-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-06-30, with a file datestamp of 2021-06-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine desulfurase SufS
    Species: Bacillus subtilis subsp. subtilis str. 168 [TaxId:224308]
    Gene: sufS, csd, yurW, BSU32690
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32164 (2-407)
      • expression tag (0-1)
      • engineered mutation (122)
      • expression tag (408-413)
    Domains in SCOPe 2.07: d7ceqa1, d7ceqa2, d7ceqa3
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7ceqA (A:)
    ghmnitdireqfpilhqqvnghdlvyldsaatsqkpravietldkyynqynsnvhrgvht
    lgtratdgyegarekvrkfinaksmaeiiftkgtttslnmvalsyaranlkpgdevvity
    meahaniipwqqavkatgatlkyiplqedgtisledvretvtsntkivavshvsnvlgtv
    npikemakiahdngavivvdgaqstphmkidvqdldcdffalsshkmcgptgvgvlygkk
    allenmepaefggemidfvglyestwkelpwkfeagtpiiagaiglgaaidfleeiglde
    isrhehklaayalerfrqldgvtvygpeeraglvtfnlddvhphdvatvldaegiavrag
    hhcaqplmkwldvtatarasfylynteeeidklvealqktkeyftnvfvdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >7ceqA (A:)
    ghmnitdireqfpilhqqvnghdlvyldsaatsqkpravietldkyynqynsnvhrgvht
    lgtratdgyegarekvrkfinaksmaeiiftkgtttslnmvalsyaranlkpgdevvity
    meahaniipwqqavkatgatlkyiplqedgtisledvretvtsntkivavshvsnvlgtv
    npikemakiahdngavivvdgaqstphmkidvqdldcdffalsshkmcgptgvgvlygkk
    allenmepaefggemidfvglyestwkelpwkfeagtpiiagaiglgaaidfleeiglde
    isrhehklaayalerfrqldgvtvygpeeraglvtfnlddvhphdvatvldaegiavrag
    hhcaqplmkwldvtatarasfylynteeeidklvealqktkeyftnvfvdlehh