PDB entry 7cei

View 7cei on RCSB PDB site
Description: the endonuclease domain of colicin e7 in complex with its inhibitor im7 protein
Deposited on 1998-09-17, released 1999-09-17
The last revision prior to the SCOP 1.61 freeze date was dated 1999-09-17, with a file datestamp of 1999-09-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.203
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d7ceia_
  • Chain 'B':
    Domains in SCOP 1.61: d7ceib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7ceiA (A:)
    melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
    rddspegivkeikewraangkpgfkqg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7ceiB (B:)
    rnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskd
    pelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvtp
    krhidih