PDB entry 7cei

View 7cei on RCSB PDB site
Description: the endonuclease domain of colicin e7 in complex with its inhibitor im7 protein
Class: immune system
Keywords: DNAse, e-group colicins, protein-protein interaction, protein recognition, immune system
Deposited on 1998-09-17, released 1999-09-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.203
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (colicin e7 immunity protein)
    Species: Escherichia coli str. K12 substr. [TaxId:316407]
    Gene: CEIE7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7ceia_
  • Chain 'B':
    Compound: protein (colicin e7 immunity protein)
    Species: Escherichia coli str. K12 substr. [TaxId:316407]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7ceib_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7ceiA (A:)
    melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
    rddspegivkeikewraangkpgfkqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >7ceiB (B:)
    erfarepmaaghrmwqmaglkaqraqtdvnnkkaafdaaakeksdadvalssalerrkqk
    enkekdakakldkeskrnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefk
    sfddfrkkfweevskdpelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpis
    qnggvydmdnisvvtpkrhidihrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >7ceiB (B:)
    rnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskd
    pelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvtp
    krhidih