PDB entry 7ccp

View 7ccp on RCSB PDB site
Description: effect of arginine-48 replacement on the reaction between cytochrome c peroxidase and hydrogen peroxide
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1993-06-07, released 1993-10-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.159
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (Start-295)
      • engineered mutation (49)
      • variant (54)
      • variant (153)
    Domains in SCOPe 2.05: d7ccpa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7ccpA (A:)
    mittplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvllawhisgtwd
    khdntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqe
    mqgpkipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalg
    kthlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysl
    iqdpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >7ccpA (A:)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvllawhisgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
    nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
    ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl