PDB entry 7c8s

View 7c8s on RCSB PDB site
Description: Crystal structure of DUSP22 mutant_N128A
Class: hydrolase
Keywords: DUSP22, atypical DUSPs, Cysteine based protein tyrosine phosphatases (Cys-based PTPs), active site of DUSPs, HYDROLASE
Deposited on 2020-06-03, released 2020-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-10-28, with a file datestamp of 2020-10-23.
Experiment type: XRAY
Resolution: 1.31 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dual specificity protein phosphatase 22
    Species: Homo sapiens [TaxId:9606]
    Gene: DUSP22, JSP1, LMWDSP2, MKPX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NRW4 (2-End)
      • expression tag (0-1)
      • engineered mutation (129)
    Domains in SCOPe 2.08: d7c8sa1, d7c8sa2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7c8sA (A:)
gpmgngmnkilpglyignfkdardaeqlsknkvthilsvhdsarpmlegvkylcipaads
psqnltrhfkesikfihecrlrgesclvhclagvsrsvtlviayimtvtdfgwedalhtv
ragrscanpavgfqrqlqefekhevhqyrqwlkeeyg

    Sequence, based on observed residues (ATOM records): (download) 
    >7c8sA (A:)
gpmgngmnkilpglyignfkdardaeqlsknkvthilsvhdsarpmlegvkylcipaads
psqnltrhfkesikfihecrlrgesclvhclagvsrsvtlviayimtvtdfgwedalhtv
ragrscanpavgfqrqlqefekhevhqyrqwlkeey