PDB entry 7c8p

View 7c8p on RCSB PDB site
Description: Structural and functional characterization of human group A rotavirus P[25] VP8*
Class: protein binding
Keywords: human P[25] rotavirus, glycan binding specificity, VP8*, histo-blood group antigen (HBGA), PROTEIN BINDING
Deposited on 2020-06-03, released 2021-04-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-14, with a file datestamp of 2021-04-09.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7c8pa_
  • Chain 'B':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7c8pb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7c8pA (A:)
vldgpyqptsfnlpvdywmmmsptqagrvaegtngtdrwfaciivepnvslqsrdyvldg
qtvqlqvdntsntmwkfilfikltksgnysqysslltnhklcawikrdsrvywfdgtvpn
ssdnyyltinndnsivssdvdfyliprtqtdscrrcinngl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7c8pB (B:)
vldgpyqptsfnlpvdywmmmsptqagrvaegtngtdrwfaciivepnvslqsrdyvldg
qtvqlqvdntsntmwkfilfikltksgnysqysslltnhklcawikrdsrvywfdgtvpn
ssdnyyltinndnsivssdvdfyliprtqtdscrrcinngl