PDB entry 7c61

View 7c61 on RCSB PDB site
Description: Crystal structure of 5-HT1B-BRIL and SRP2070_Fab complex
Class: signaling protein
Keywords: GPCR, BRIL, Crystallization, Antibody, SIGNALING PROTEIN
Deposited on 2020-05-21, released 2020-07-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-24.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-hydroxytryptamine receptor 1B,Soluble cytochrome b562,5-hydroxytryptamine receptor 1B
    Species: Homo sapiens [TaxId:9606]
    Gene: HTR1B, HTR1DB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28222 (Start-207)
      • engineered mutation (106)
    • Uniprot P0ABE7 (208-313)
      • engineered mutation (214)
      • engineered mutation (309)
      • engineered mutation (313)
    • Uniprot P28222
  • Chain 'H':
    Compound: IGG Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 7C61 (0-End)
  • Chain 'L':
    Compound: IGG Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 7C61 (0-End)
    Domains in SCOPe 2.08: d7c61l1, d7c61l2
  • Heterogens: ERM

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download) 
    >7c61L (L:)
divltqspatlsvtpgdrvslscrasqsvsnylhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpltfgagtklelrradaaptvsifpp
sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
ltkdeyerhnsytceathktstspivksfnrnec

    Sequence, based on observed residues (ATOM records): (download) 
    >7c61L (L:)
divltqspatlsvtpgdrvslscrasqsvsnylhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpltfgagtklelrradaaptvsifpp
sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
ltkdeyerhnsytceathktstspivksfnrne