PDB entry 7c3z

View 7c3z on RCSB PDB site
Description: the structure of class ii tumor suppressor protein h-rev107
Deposited on 2020-05-14, released 2021-05-19
The last revision was dated 2021-05-19, with a file datestamp of 2021-05-14.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HRAS-like suppressor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PLAAT3, HRASLS3, HREV107, PLA2G16
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >7c3zA (A:)
ipepkpgdlieifrpfyrhwaiyvgdgyvvhlappsevagagaasvmsaltdkaivkkel
lydvagsdkyqvnnkhddkysplpcskiiqraeelvgqevlykltsencehfvnelrygv
ahhhhhh

    Sequence, based on observed residues (ATOM records):
    >7c3zA (A:)
ipepkpgdlieifrpfyrhwaiyvgdgyvvhlappaivkkellydvagsdkyqvnnkhdd
kysplpcskiiqraeelvgqevlykltsencehfvnelrygva