PDB entry 7c2p

View 7c2p on RCSB PDB site
Description: structure of egk peptide
Deposited on 2020-05-08, released 2020-09-09
The last revision was dated 2020-09-09, with a file datestamp of 2020-09-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plant defensing Egk
    Species: Elaeis guineensis [TaxId:51953]
    Database cross-references and differences (RAF-indexed):
    • PDB 7C2P (0-46)
  • Chain 'B':
    Compound: Plant defensing Egk
    Species: Elaeis guineensis [TaxId:51953]
    Database cross-references and differences (RAF-indexed):
    • PDB 7C2P (0-46)
  • Chain 'C':
    Compound: Plant defensing Egk
    Species: Elaeis guineensis [TaxId:51953]
    Database cross-references and differences (RAF-indexed):
    • PDB 7C2P (0-46)
  • Chain 'D':
    Compound: Plant defensing Egk
    Species: Elaeis guineensis [TaxId:51953]
    Database cross-references and differences (RAF-indexed):
    • PDB 7C2P (0-46)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >7c2pA (A:)
rtcesqshkfkgpclrasncanvcktegfhggkcrgfrrrcfctkhc

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >7c2pB (B:)
rtcesqshkfkgpclrasncanvcktegfhggkcrgfrrrcfctkhc

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >7c2pC (C:)
rtcesqshkfkgpclrasncanvcktegfhggkcrgfrrrcfctkhc

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >7c2pD (D:)
rtcesqshkfkgpclrasncanvcktegfhggkcrgfrrrcfctkhc