PDB entry 7c20

View 7c20 on RCSB PDB site
Description: Crystal structure of Rabies virus (Nishigahara strain) phosphoprotein C-terminal domain (K214A)
Class: viral protein
Keywords: phosphoprotein, VIRAL PROTEIN
Deposited on 2020-05-06, released 2021-03-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-17, with a file datestamp of 2021-03-12.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoprotein
    Species: Rabies virus (strain Nishigahara RCEH) [TaxId:11298]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9IPJ8
      • engineered mutation (31)
    Domains in SCOPe 2.08: d7c20a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7c20A (A:)
ghmwsatneeddlsveaeiahqiaesfskkyafpsrssgiflynfeqlkmnlddivkeak
nvpgvtrlahdgsklplrcvlgwvalanskkfqllveanklnkimqddlnryasc

    Sequence, based on observed residues (ATOM records): (download) 
    >7c20A (A:)
dlsveaeiahqiaesfskkyafpsrssgiflynfeqlkmnlddivkeaknvpgvtrlahd
gsklplrcvlgwvalanskkfqllveanklnkimqddlnrya