PDB entry 7bxz

View 7bxz on RCSB PDB site
Description: Crystal structure of the aminoglycoside 6'-N-acetyltransferase from Enterococcus faecium
Class: transferase
Keywords: aminoglycoside acetyltransferase, Enterococcus faecium, acetyl-CoA, TRANSFERASE
Deposited on 2020-04-21, released 2020-08-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-08-12, with a file datestamp of 2020-08-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminoglycoside 6'-N-acetyltransferase
    Species: Enterococcus faecium [TaxId:1352]
    Gene: aac(6')-Ii
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7bxza_
  • Chain 'B':
    Compound: aminoglycoside 6'-N-acetyltransferase
    Species: Enterococcus faecium [TaxId:1352]
    Gene: aac(6')-Ii
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7bxzb_
  • Chain 'C':
    Compound: aminoglycoside 6'-N-acetyltransferase
    Species: Enterococcus faecium [TaxId:1352]
    Gene: aac(6')-Ii
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7bxzc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7bxzA (A:)
    miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
    gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
    sqtdlyvhtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprpd
    sq
    

    Sequence, based on observed residues (ATOM records): (download)
    >7bxzA (A:)
    miisefdrnnpvlkdqlsdllrltwpessaeeveemmnperiavaavdqdelvgfigaip
    qygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttlsqtd
    lyvhtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >7bxzB (B:)
    miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
    gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
    sqtdlyvhtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprpd
    sq
    

    Sequence, based on observed residues (ATOM records): (download)
    >7bxzB (B:)
    miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
    gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
    sqtdlyvhtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprpd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >7bxzC (C:)
    miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
    gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
    sqtdlyvhtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprpd
    sq
    

    Sequence, based on observed residues (ATOM records): (download)
    >7bxzC (C:)
    miisefdrnnpvlkdqlsdllrltwpeesaeeveemmnperiavaavdqdelvgfigaip
    qygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttlsqtd
    lyvhtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprpd