PDB entry 7bwo

View 7bwo on RCSB PDB site
Description: consensus chitin binding protein
Deposited on 2020-04-15, released 2021-04-14
The last revision was dated 2021-04-21, with a file datestamp of 2021-04-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chitin binding beak protein 3
    Species: Dosidicus gigas [TaxId:346249]
    Gene: CBP-3
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >7bwoA (A:)
qsmrtecntargkghmliaypgdcsqyiscdsndqspqqcasgtvfnsekqrcdfranvp
sckv