PDB entry 7bwh

View 7bwh on RCSB PDB site
Description: Soluble cytochrome b5 from Ramazzottius varieornatus
Class: electron transport
Keywords: heme protein, cytochrome b5, ELECTRON TRANSPORT
Deposited on 2020-04-14, released 2020-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-08-05, with a file datestamp of 2020-07-31.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome b5 heme-binding domain-containing protein
    Species: Ramazzottius varieornatus [TaxId:947166]
    Gene: RvY_13572-1, RvY_13572.1, RvY_13572
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7bwha_
  • Heterogens: HEM, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7bwhA (A:)
hhhhhhssenlyfqslrkdkaeeqtfswseisqhtsanslwvvvrdktspgsplrvydvt
nfqkthpgghlillkyagtecsrafaavghskyaikrmsqyrigiaeadnve

    Sequence, based on observed residues (ATOM records): (download) 
    >7bwhA (A:)
eeqtfswseisqhtsanslwvvvrdktspgsplrvydvtnfqkthpgghlillkyagtec
srafaavghskyaikrmsqyrigiaead