PDB entry 7bwf

View 7bwf on RCSB PDB site
Description: YoeB-YefM complex from Staphylococcus aureus
Class: toxin/antitoxin
Keywords: Toxin-Antitoxin complex ribosome-dependent ribonuclease ribosome-independent ribonuclease Toxin inhibitor, TOXIN, TOXIN-ANTITOXIN complex
Deposited on 2020-04-14, released 2020-05-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-05-20, with a file datestamp of 2020-05-15.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Addiction module antitoxin RelB
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: M1K003_0948, SAKG03_24000
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A3A3ATA4 (0-86)
  Domains in SCOPe 2.08: d7bwfa_
• Chain 'B':
  Compound: Antitoxin
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: yefM, BTN44_14530, EP54_09735, EQ90_00255, HMPREF3211_00052, M1K003_0949, NCTC10654_02579, NCTC10702_03766, NCTC5664_01444, NCTC6133_03236, NCTC7988_02488, RK64_12840, SAKG03_24010
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0B4ND47 (9-91)
    • expression tag (0-8)
  Domains in SCOPe 2.08: d7bwfb1, d7bwfb2
• Chain 'C':
  Compound: Addiction module antitoxin RelB
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: M1K003_0948, SAKG03_24000
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A3A3ATA4 (0-86)
  Domains in SCOPe 2.08: d7bwfc_
• Chain 'D':
  Compound: Antitoxin
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: yefM, BTN44_14530, EP54_09735, EQ90_00255, HMPREF3211_00052, M1K003_0949, NCTC10654_02579, NCTC10702_03766, NCTC5664_01444, NCTC6133_03236, NCTC7988_02488, RK64_12840, SAKG03_24010
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0B4ND47 (8-90)
    • expression tag (0-7)
  Domains in SCOPe 2.08: d7bwfd1, d7bwfd2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7bwfA (A:)
  arlnitfspqafedykyfqqnnkkmvkkinellksidrngalegigkpeklksnltgyys
  rrinhehrlvytvddnhikiasckyhy
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7bwfB (B:)
  sglvprgshmiiknysyarqnlkalmtkvnddsdmvtvtstddknvvimsesdynsmmet
  lylqqnpnnaehlaqsiadlergktitkdidv
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7bwfC (C:)
  arlnitfspqafedykyfqqnnkkmvkkinellksidrngalegigkpeklksnltgyys
  rrinhehrlvytvddnhikiasckyhy
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7bwfD (D:)
  glvprgshmiiknysyarqnlkalmtkvnddsdmvtvtstddknvvimsesdynsmmetl
  ylqqnpnnaehlaqsiadlergktitkdidv