PDB entry 7bvg

View 7bvg on RCSB PDB site
Description: Cryo-EM structure of Mycobacterium smegmatis arabinosyltransferase EmbA-EmbB-AcpM2 in complex with di-arabinose.
Class: transferase
Keywords: Mycobacterium smegmatis, cell wall synthesis, drug target, ethambutol, arabinosyltransferase, EmbA, EmbB, EmbC, acyl carrier protein, arabinogalactan, lipoarabinomannan, drug resistance, TRANSFERASE
Deposited on 2020-04-10, released 2020-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: EM
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Integral membrane indolylacetylinositol arabinosyltransferase EmbA
  Species: Mycolicibacterium smegmatis MC2 155 [TaxId:246196]
  Gene: embA
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0R613 (Start-1087)
• Chain 'B':
  Compound: Integral membrane indolylacetylinositol arabinosyltransferase EmbB
  Species: Mycolicibacterium smegmatis MC2 155 [TaxId:246196]
  Gene: embB, MSMEI_6221
  Database cross-references and differences (RAF-indexed):
  • Uniprot I7GAQ2 (Start-1081)
• Chain 'P':
  Compound: meromycolate extension acyl carrier protein
  Species: Mycolicibacterium smegmatis MC2 155 [TaxId:246196]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0R0B3
  Domains in SCOPe 2.08: d7bvgp_
• Heterogens: CDL, F8L, PNS, CA, PO4

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'P':
  Sequence, based on SEQRES records: (download)
  

  >7bvgP (P:)
  maatqeeiiaglaeiieevtgiepsevtpeksfvddldidslsmveiavqtedkygvkip
  dedlaglrtvgdvvayiqkleeenpeaaaalrekfaadq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >7bvgP (P:)
  aatqeeiiaglaeiieevtgiepsevtpeksfvddldidslsmveiavqtedkygvkipd
  edlaglrtvgdvvayiqkleeenpeaaaalrek