PDB entry 7bu5

View 7bu5 on RCSB PDB site
Description: crystal structure of human slx4 and mus81
Deposited on 2020-04-04, released 2021-04-07
The last revision was dated 2021-04-07, with a file datestamp of 2021-04-02.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MUS81 endonuclease homolog (Yeast), isoform CRA_b
    Species: Homo sapiens [TaxId:9606]
    Gene: MUS81, hCG_23303
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: structure-specific endonuclease subunit slx4
    Species: Homo sapiens [TaxId:9606]
    Gene: SLX4, BTBD12, KIAA1784, KIAA1987
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GLY, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >7bu5A (A:)
aapvrlgrkrplpacpnplfvrwltewrdeatrsrhrtrfvfqkalrslrryplplrsgk
eakilqhfgdglcrmlderlqrhrtsggdhapdspsge

    Sequence, based on observed residues (ATOM records):
    >7bu5A (A:)
pvrlgrkrplpacpnplfvrwltewrdeatrsrhrtrfvfqkalrslrryplplrsgkea
kilqhfgdglcrmlderlqrhrts

  • Chain 'B':
    Sequence, based on SEQRES records:
    >7bu5B (B:)
rkknlppkvpitpmpqysimetpvlkkeldrfgvrplpkrqmvlklkeifqythqtldsd
s

    Sequence, based on observed residues (ATOM records):
    >7bu5B (B:)
vpitpmpqysimetpvlkkeldrfgvrplpkrqmvlklkeifqythqtl