PDB entry 7brt

View 7brt on RCSB PDB site
Description: Crystal structure of Sec62 LIR fused to GABARAP
Class: membrane protein
Keywords: autophagy, endoplasmic reticulum, MEMBRANE PROTEIN
Deposited on 2020-03-30, released 2020-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-22, with a file datestamp of 2020-07-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translocation protein SEC62,Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Gabarap
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99442 (2-17)
      • expression tag (0-1)
      • engineered mutation (8)
    • Uniprot O95166 (18-133)
      • engineered mutation (20-21)
    Domains in SCOPe 2.08: d7brta1, d7brta2
  • Chain 'B':
    Compound: Translocation protein SEC62,Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Gabarap
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99442 (2-17)
      • expression tag (0-1)
      • engineered mutation (8)
    • Uniprot O95166 (18-133)
      • engineered mutation (20-21)
    Domains in SCOPe 2.08: d7brtb1, d7brtb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7brtA (A:)
    gpndfemidkeeleqqtdmkstykeehpfekrrsegekirkkypdrvpvivekapkarig
    dldkkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheed
    fflyiaysdesvyg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7brtB (B:)
    gpndfemidkeeleqqtdmkstykeehpfekrrsegekirkkypdrvpvivekapkarig
    dldkkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheed
    fflyiaysdesvyg