PDB entry 7brt

View 7brt on RCSB PDB site
Description: Crystal structure of Sec62 LIR fused to GABARAP
Class: membrane protein
Keywords: autophagy, endoplasmic reticulum, MEMBRANE PROTEIN
Deposited on 2020-03-30, released 2020-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-22, with a file datestamp of 2020-07-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Translocation protein SEC62,Gamma-aminobutyric acid receptor-associated protein
  Species: Homo sapiens [TaxId:9606]
  Gene: Gabarap
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99442 (2-17)
    • expression tag (0-1)
    • engineered mutation (8)
  • Uniprot O95166 (18-133)
    • engineered mutation (20-21)
  Domains in SCOPe 2.08: d7brta1, d7brta2
• Chain 'B':
  Compound: Translocation protein SEC62,Gamma-aminobutyric acid receptor-associated protein
  Species: Homo sapiens [TaxId:9606]
  Gene: Gabarap
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99442 (2-17)
    • expression tag (0-1)
    • engineered mutation (8)
  • Uniprot O95166 (18-133)
    • engineered mutation (20-21)
  Domains in SCOPe 2.08: d7brtb1, d7brtb2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7brtA (A:)
  gpndfemidkeeleqqtdmkstykeehpfekrrsegekirkkypdrvpvivekapkarig
  dldkkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheed
  fflyiaysdesvyg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7brtB (B:)
  gpndfemidkeeleqqtdmkstykeehpfekrrsegekirkkypdrvpvivekapkarig
  dldkkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheed
  fflyiaysdesvyg