PDB entry 7brn

View 7brn on RCSB PDB site
Description: Crystal structure of Atg40 AIM fused to Atg8
Class: membrane protein
Keywords: autophagy, endoplasmic reticulum, MEMBRANE PROTEIN
Deposited on 2020-03-29, released 2020-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-22, with a file datestamp of 2020-07-17.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Autophagy-related protein 40,Autophagy-related protein 8
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: ATG8, APG8, AUT7, CVT5, YBL078C, YBL0732
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99325 (2-17)
      • expression tag (0-1)
    • Uniprot P38182 (18-End)
      • engineered mutation (43)
    Domains in SCOPe 2.08: d7brna1, d7brna2
  • Heterogens: ALE, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7brnA (A:)
gpefpndydfmedildetmkstfkseypfekrkaeseriadrfpnripvicekaeksdip
eidkrkylvpadltvgqfvyvirkrimlppekaififvndtlpptaalmsaiyqehkdkd
gflyvtysgentfg

    Sequence, based on observed residues (ATOM records): (download) 
    >7brnA (A:)
gpefpndydfmedildetmkstfkseypfekrkaeseriadrfpnripvicekaeksdip
eidkrkylvpadltvgqfvyvirkrimlppekaififvndtlpptaalmsaiyqehkdkd
gflyvtysgentf