PDB entry 7bpn

View 7bpn on RCSB PDB site
Description: solution nmr structure of nf7; de novo designed protein with a novel fold
Deposited on 2020-03-23, released 2021-03-24
The last revision was dated 2021-03-24, with a file datestamp of 2021-03-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nf7
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 7BPN (0-123)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >7bpnA (A:)
gqiqyfnvdenpeqvrklieqagldpdelreaeviiiiisrtpeqleklsrqvkelgadr
llefnvdenpeqasklaktagisekqlreadyiililvrdekkakkfadslrkkgslehh
hhhh