PDB entry 7bo9

View 7bo9 on RCSB PDB site
Description: a hexameric de novo coiled-coil assembly: cc-type2-(vayd)4-y3f- w19(brphe).
Deposited on 2021-01-24, released 2021-05-19
The last revision was dated 2021-05-19, with a file datestamp of 2021-05-14.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: CC-Type2-(VaYd)4-Y3F-W19(BrPhe)
  Species: synthetic construct, synthetic [TaxId:32630]
  Database cross-references and differences (RAF-indexed):
  • PDB 7BO9
• Chain 'B':
  Compound: CC-Type2-(VaYd)4-Y3F-W19(BrPhe)
  Species: synthetic construct, synthetic [TaxId:32630]
  Database cross-references and differences (RAF-indexed):
  • PDB 7BO9
• Chain 'C':
  Compound: CC-Type2-(VaYd)4-Y3F-W19(BrPhe)
  Species: synthetic construct, synthetic [TaxId:32630]
  Database cross-references and differences (RAF-indexed):
  • PDB 7BO9
• Chain 'D':
  Compound: CC-Type2-(VaYd)4-Y3F-W19(BrPhe)
  Species: synthetic construct, synthetic [TaxId:32630]
  Database cross-references and differences (RAF-indexed):
  • PDB 7BO9
• Chain 'E':
  Compound: CC-Type2-(VaYd)4-Y3F-W19(BrPhe)
  Species: synthetic construct, synthetic [TaxId:32630]
  Database cross-references and differences (RAF-indexed):
  • PDB 7BO9
• Chain 'F':
  Compound: CC-Type2-(VaYd)4-Y3F-W19(BrPhe)
  Species: synthetic construct, synthetic [TaxId:32630]
  Database cross-references and differences (RAF-indexed):
  • PDB 7BO9
• Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >7bo9A (A:)
  gefaqavkeyakavkeyayavkeyaqavkg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >7bo9B (B:)
  gefaqavkeyakavkeyayavkeyaqavkg
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >7bo9C (C:)
  gefaqavkeyakavkeyayavkeyaqavkg
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records:
  

  >7bo9D (D:)
  gefaqavkeyakavkeyayavkeyaqavkg
  

  
  
• Chain 'E':
  Sequence, based on SEQRES records:
  

  >7bo9E (E:)
  gefaqavkeyakavkeyayavkeyaqavkg
  

  
  Sequence, based on observed residues (ATOM records):
  

  >7bo9E (E:)
  gefaqavkeyakavkeyayavkeyaqavk
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records:
  

  >7bo9F (F:)
  gefaqavkeyakavkeyayavkeyaqavkg