PDB entry 7bml

View 7bml on RCSB PDB site
Description: Crystal structure of outer surface protein C (OspC) from Borrelia burgdorferi
Class: unknown function
Keywords: Lyme disease, tick-borne disease, OspC, Borrelia burgdorferi, UNKNOWN FUNCTION
Deposited on 2021-01-20, released 2021-02-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-10, with a file datestamp of 2021-02-05.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: outer surface protein c
    Species: Borrelia burgdorferi [TaxId:139]
    Gene: ospC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7bmla_
  • Chain 'B':
    Compound: outer surface protein c
    Species: Borrelia burgdorferi [TaxId:139]
    Gene: ospC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7bmlb_
  • Chain 'C':
    Compound: outer surface protein c
    Species: Borrelia burgdorferi [TaxId:139]
    Gene: ospC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7bmlc_
  • Chain 'D':
    Compound: outer surface protein c
    Species: Borrelia burgdorferi [TaxId:139]
    Gene: ospC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7bmld_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7bmlA (A:)
    kgpnlteiskkitdsnavllavkeveallssidelakaigkkikndgslgdeanhnesll
    agaytistlitqklsklngseglkekiaaakkcseefstklkdnhaqlgiqgvtdenakk
    ailkanaagkdkgveeleklsgsleslskaakemlansvkeltspvvaespkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >7bmlA (A:)
    nlteiskkitdsnavllavkeveallssidelakaigkkikndgslgdeanhnesllaga
    ytistlitqklsklngseglkekiaaakkcseefstklkdnhaqlgiqgvtdenakkail
    kanaagkdkgveeleklsgsleslskaakemlansvkelts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >7bmlB (B:)
    kgpnlteiskkitdsnavllavkeveallssidelakaigkkikndgslgdeanhnesll
    agaytistlitqklsklngseglkekiaaakkcseefstklkdnhaqlgiqgvtdenakk
    ailkanaagkdkgveeleklsgsleslskaakemlansvkeltspvvaespkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >7bmlB (B:)
    lteiskkitdsnavllavkeveallssidelakaigkkikndgslgdeanhnesllagay
    tistlitqklsklngseglkekiaaakkcseefstklkdnhaqlgiqgvtdenakkailk
    anaagkdkgveeleklsgsleslskaakemlansvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >7bmlC (C:)
    kgpnlteiskkitdsnavllavkeveallssidelakaigkkikndgslgdeanhnesll
    agaytistlitqklsklngseglkekiaaakkcseefstklkdnhaqlgiqgvtdenakk
    ailkanaagkdkgveeleklsgsleslskaakemlansvkeltspvvaespkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >7bmlC (C:)
    lteiskkitdsnavllavkeveallssidelakaigkkikndgslgdeanhnesllagay
    tistlitqklsklngseglkekiaaakkcseefstklkdnhaqlgiqgvtdenakkailk
    anaagkdkgveeleklsgsleslskaakemlansvkelt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >7bmlD (D:)
    kgpnlteiskkitdsnavllavkeveallssidelakaigkkikndgslgdeanhnesll
    agaytistlitqklsklngseglkekiaaakkcseefstklkdnhaqlgiqgvtdenakk
    ailkanaagkdkgveeleklsgsleslskaakemlansvkeltspvvaespkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >7bmlD (D:)
    lteiskkitdsnavllavkeveallssidelakaigkkikndgslgdeanhnesllagay
    tistlitqklsklngseglkekiaaakkcseefstklkdnhaqlgiqgvtdenakkailk
    anaagkdkgveeleklsgsleslskaakemlansvkeltspvva