PDB entry 7biv

View 7biv on RCSB PDB site
Description: Inhibitor of MDM2-p53 Interaction
Class: apoptosis
Keywords: ligase, cell cycle, apoptosis, protein binding
Deposited on 2021-01-13, released 2021-04-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-21, with a file datestamp of 2021-04-16.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (5-End)
      • engineered mutation (57-58)
    Domains in SCOPe 2.08: d7biva_
  • Heterogens: TUW, DMS, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7bivA (A:)
    gplgssqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydaaq
    qhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >7bivA (A:)
    sqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydaaqqhivy
    csndllgdlfgvpsfsvkehrkiytmiyrnlv