PDB entry 7be3

View 7be3 on RCSB PDB site
Description: Human Galectin-3 in complex with LacdiNAc
Class: sugar binding protein
Keywords: Galectin-3, LacdiNAc, LDN, glycan, lectin, immune, SUGAR BINDING PROTEIN
Deposited on 2020-12-22, released 2021-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-02, with a file datestamp of 2021-05-28.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Galectin-3
  Species: Homo sapiens [TaxId:9606]
  Gene: LGALS3, MAC2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17931 (1-137)
    • initiating methionine (0)
  Domains in SCOPe 2.08: d7be3a1, d7be3a2
• Heterogens: NGA, NDG, GOL, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7be3A (A:)
  mlivpynlplpggvvprmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrviv
  cntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneis
  klgisgdidltsasytmi