PDB entry 7bbm

View 7bbm on RCSB PDB site
Description: Mutant nitrobindin M75L/H76L/Q96C/M148L (NB4H) from Arabidopsis thaliana with cofactor MnPPIX
Class: transport protein
Keywords: beta-barrel, intracellular transport, transport protein, metal cofactor, porphyrin cofactor, mnppix, nitrobindin
Deposited on 2020-12-18, released 2021-05-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-05-26, with a file datestamp of 2021-05-21.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: N/A
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0678 fatty acid-binding protein-like protein At1g79260
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At1g79260, YUP8H12R.14
    Database cross-references and differences (RAF-indexed):
    • Uniprot O64527 (Start-165)
      • engineered mutation (74-75)
      • engineered mutation (95)
      • engineered mutation (147)
    Domains in SCOPe 2.08: d7bbma_
  • Heterogens: MNH, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7bbmA (A:)
    mnqlqqlqnpgesppvhpfvaplsyllgtwrgqgegeyptipsfrygeeirfshsgkpvi
    aytqktwklesgapllaesgyfrprpdgsievviacstglvevqkgtynvdeqsiklksd
    lvgnaskvkeisrefelvdgklsyvvrlstttnplqphlkaildkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >7bbmA (A:)
    ppvhpfvaplsyllgtwrgqgegeyptipsfrygeeirfshsgkpviaytqktwklesga
    pllaesgyfrprpdgsievviacstglvevqkgtynvdeqsiklksdlvgnaskvkeisr
    efelvdgklsyvvrlstttnplqphlkaildkl