PDB entry 7b92
View 7b92 on RCSB PDB site
Description: Structure of a minimal SF3B core in complex with sudemycin D6 (form II)
Class: splicing
Keywords: SF3B, pre-mRNA splicing, splicing modulator, sudemycin D6, SPLICING
Deposited on
2020-12-14, released
2021-08-04
The last revision prior to the SCOPe 2.08 freeze date was dated
2021-08-04, with a file datestamp of
2021-07-30.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.21
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Splicing factor 3B subunit 3
Species: Homo sapiens [TaxId:9606]
Gene: SF3B3, KIAA0017, SAP130
Database cross-references and differences (RAF-indexed):
- Uniprot Q15393 (10-451)
- expression tag (0-9)
- linker (452-458)
- Uniprot Q15393 (459-889)
- Chain 'B':
Compound: Splicing factor 3B subunit 5
Species: Homo sapiens [TaxId:9606]
Gene: SF3B5, SF3B10
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Splicing factor 3B subunit 1
Species: Homo sapiens [TaxId:9606]
Gene: SF3B1, SAP155
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: PHD finger-like domain-containing protein 5A
Species: Homo sapiens [TaxId:9606]
Gene: PHF5A
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d7b92d_ - Heterogens: T2W, ZN, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
Sequence, based on SEQRES records: (download)
>7b92D (D:)
gplgspgsramakhhpdlifcrkqagvaigrlcekcdgkcvicdsyvrpctlvricdecn
ygsyqgrcvicggpgvsdayyckectiqekdrdgcpkivnlgssktdl
Sequence, based on observed residues (ATOM records): (download)
>7b92D (D:)
pdlifcrkqagvaigrlcekcdgkcvicdsyvrpctlvricdecnygsyqgrcvicggpg
vsdayyckectiqekdrdgcpkivnlgssktdl