PDB entry 7b92

View 7b92 on RCSB PDB site
Description: Structure of a minimal SF3B core in complex with sudemycin D6 (form II)
Class: splicing
Keywords: SF3B, pre-mRNA splicing, splicing modulator, sudemycin D6, SPLICING
Deposited on 2020-12-14, released 2021-08-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-08-04, with a file datestamp of 2021-07-30.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Splicing factor 3B subunit 3
    Species: Homo sapiens [TaxId:9606]
    Gene: SF3B3, KIAA0017, SAP130
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15393 (10-451)
      • expression tag (0-9)
      • linker (452-458)
    • Uniprot Q15393 (459-889)
      • expression tag (890-898)
  • Chain 'B':
    Compound: Splicing factor 3B subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: SF3B5, SF3B10
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Splicing factor 3B subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SF3B1, SAP155
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: PHD finger-like domain-containing protein 5A
    Species: Homo sapiens [TaxId:9606]
    Gene: PHF5A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7RTV0 (10-107)
      • expression tag (0-9)
    Domains in SCOPe 2.08: d7b92d_
  • Heterogens: T2W, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >7b92D (D:)
    gplgspgsramakhhpdlifcrkqagvaigrlcekcdgkcvicdsyvrpctlvricdecn
    ygsyqgrcvicggpgvsdayyckectiqekdrdgcpkivnlgssktdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >7b92D (D:)
    pdlifcrkqagvaigrlcekcdgkcvicdsyvrpctlvricdecnygsyqgrcvicggpg
    vsdayyckectiqekdrdgcpkivnlgssktdl