PDB entry 7b51

View 7b51 on RCSB PDB site
Description: Crystal structure of human CRM1 covalently modified by 2-mercaptoethanol at Cys528
Class: nuclear protein
Keywords: Exportin, Inhibition, NUCLEAR PROTEIN
Deposited on 2020-12-03, released 2021-03-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-17, with a file datestamp of 2021-03-12.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exportin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: Xpo1, Crm1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14980
      • engineered mutation (443-445)
  • Chain 'B':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: RAN, ARA24, OK/SW-cl.81
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826
      • engineered mutation (70)
    Domains in SCOPe 2.08: d7b51b_
  • Heterogens: BME, GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >7b51B (B:)
mgmaaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgp
ikfnvwdtaglekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipiv
lcgnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefva
mp

    Sequence, based on observed residues (ATOM records): (download) 
    >7b51B (B:)
epqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwd
taglekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvd
ikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvam